SPANXB1 (NM_032461) Human Mass Spec Standard
CAT#: PH321009
SPANXB1 MS Standard C13 and N15-labeled recombinant protein (NP_115850)
View other "SPANXB1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SPANXB1 MS Standard C13 and N15-labeled recombinant protein (NP_115850) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221009 |
| Predicted MW | 11.8 kDa |
| Protein Sequence |
>RC221009 protein sequence
Red=Cloning site Green=Tags(s) MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSP EELVNDHARENRINPDQMEEEEFIEITTERPKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115850 |
| RefSeq Size | 469 |
| RefSeq ORF | 309 |
| Synonyms | B1; CT11.2; SPANX-B; SPANXB; SPANXB2; SPANXF1; SPANXF2 |
| Locus ID | 728695 |
| Cytogenetics | Xq27.1 |
| Summary | Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular family member contains an additional 18 nucleotides in its coding region compared to the other family members in the same gene cluster. This family member is also subject to gene copy number variation. Although the protein encoded by this gene contains consensus nuclear localization signals, the major site for subcellular localization of expressed protein is in the cytoplasmic droplets of ejaculated spermatozoa. This protein provides a biochemical marker for studying the unique structures in spermatazoa, while attempting to further define its role in spermatogenesis. [provided by RefSeq, Apr 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410096 | SPANXB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410096 | Transient overexpression lysate of SPANX family, member B1 (SPANXB1) |
CNY 3080.00 |
|
| TP321009 | Purified recombinant protein of Homo sapiens SPANX family, member B1 (SPANXB1), 20 µg |
CNY 2900.00 |
其它SPANXB1产品
