NUMB (NM_001005743) Human Mass Spec Standard
CAT#: PH320960
NUMB MS Standard C13 and N15-labeled recombinant protein (NP_001005743)
View other "NUMB" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | NUMB MS Standard C13 and N15-labeled recombinant protein (NP_001005743) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220960 |
Predicted MW | 70.6 kDa |
Protein Sequence |
>RC220960 representing NM_001005743
Red=Cloning site Green=Tags(s) MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK FFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI CHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAKREEIM KQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF PALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM TKPVTVVAPQSPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTS QPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQ TFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQR TNPSPTNPFSSDLQKTFEIEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001005743 |
RefSeq Size | 3647 |
RefSeq ORF | 1953 |
Synonyms | C14orf41; c14_5527; S171 |
Locus ID | 8650 |
Cytogenetics | 14q24.2-q24.3 |
Summary | The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Pathways | Notch signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401229 | NUMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC423643 | NUMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC423644 | NUMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401229 | Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 3 |
CNY 4840.00 |
|
LY423643 | Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 1 |
CNY 4840.00 |
|
LY423644 | Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 2 |
CNY 4840.00 |
|
PH321018 | NUMB MS Standard C13 and N15-labeled recombinant protein (NP_001005744) |
CNY 19520.00 |
|
TP320960 | Recombinant protein of human numb homolog (Drosophila) (NUMB), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP321018 | Recombinant protein of human numb homolog (Drosophila) (NUMB), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP710054 | Recombinant protein of human numb homolog (Drosophila)(MUMB),residues 1-603aa, with C-terminal flag tag,expressed in sf9 cells |
CNY 4020.00 |
|
TP761513 | Purified recombinant protein of Human numb homolog (Drosophila) (NUMB), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |