SEC23B (NM_032986) Human Mass Spec Standard
CAT#: PH320880
SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_116781)
View other "SEC23B" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_116781) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220880 |
| Predicted MW | 86.3 kDa |
| Protein Sequence |
>RC220880 representing NM_032986
Red=Cloning site Green=Tags(s) MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAVL NPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLYVVDTCLE EDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPA MPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGT FPNTGARIMLFTGGPPTQGPGMVVGDELKIPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIY ACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKDFNGDFRMAFGATLDVKTSRELKIAG AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNTPIPQGGRGAIQFVTHYQHS STQRRIRVTTIARNWADVQSQLRHIEAAFDQEAAAVLMARLGVFRAESEEGPDVLRWLDRQLIRLCQKFG QYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPILYSYSF HGPPEPVLLDSSSILADRILLMDTFFQIVIYLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQA RFPMPRYINTEHGGSQARFLLSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116781 |
| RefSeq Size | 3126 |
| RefSeq ORF | 2301 |
| Synonyms | CDA-II; CDAII; CDAN2; CWS7; HEMPAS; hSec23B |
| Locus ID | 10483 |
| Cytogenetics | 20p11.23 |
| Summary | The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants have been identified in this gene. [provided by RefSeq, Feb 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403219 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409758 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416692 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403219 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 2 |
CNY 3080.00 |
|
| LY409758 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 3 |
CNY 3080.00 |
|
| LY416692 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1 |
CNY 3080.00 |
|
| PH310572 | SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_116780) |
CNY 19520.00 |
|
| PH317911 | SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_006354) |
CNY 19520.00 |
|
| TP310572 | Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP317911 | Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP320880 | Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 3, 20 µg |
CNY 2900.00 |
