PHYHIP (NM_001099335) Human Mass Spec Standard
CAT＃: PH320713
PHYHIP MS Standard C13 and N15-labeled recombinant protein (NP_001092805)
View other "PHYHIP" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | PHYHIP MS Standard C13 and N15-labeled recombinant protein (NP_001092805) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220713 |
| Predicted MW | 37.6 kDa |
| Protein Sequence |
>RC220713 protein sequence
Red=Cloning site Green=Tags(s) MELLSTPHSIEINNITCDSFSISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPM TVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVF YRNHHKEYFEHARTHCGNMLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPA QRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSMGDRFCRDRRPLLDIACNKFLTCSVEDGELVFRHAQ DLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001092805 |
| RefSeq Size | 3354 |
| RefSeq ORF | 990 |
| Synonyms | DYRK1AP3; PAHX-AP; PAHXAP1 |
| Locus ID | 9796 |
| Cytogenetics | 8p21.3 |
| Summary | Its interaction with PHYH suggests a role in the development of the central system.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415057 | PHYHIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420432 | PHYHIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415057 | Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 2 |
CNY 3080.00 |
|
| LY420432 | Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 1 |
CNY 3080.00 |
|
| PH305205 | PHYHIP MS Standard C13 and N15-labeled recombinant protein (NP_055574) |
CNY 19520.00 |
|
| TP305205 | Recombinant protein of human phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP320713 | Recombinant protein of human phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 1, 20 µg |
CNY 2900.00 |
