NR2E3 (NM_016346) Human Mass Spec Standard
CAT#: PH320677
NR2E3 MS Standard C13 and N15-labeled recombinant protein (NP_057430)
View other "NR2E3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | NR2E3 MS Standard C13 and N15-labeled recombinant protein (NP_057430) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220677 |
| Predicted MW | 39.6 kDa |
| Protein Sequence |
>RC220677 representing NM_016346
Red=Cloning site Green=Tags(s) METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYGIYACNGCSGF FKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTE SRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYS SSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAP PEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQ VMLSQHSKAHHPSQPVR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057430 |
| RefSeq Size | 2108 |
| RefSeq ORF | 1101 |
| Synonyms | ESCS; PNR; rd7; RNR; RP37 |
| Locus ID | 10002 |
| Cytogenetics | 15q23 |
| Summary | This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402296 | NR2E3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414039 | NR2E3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429495 | NR2E3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402296 | Transient overexpression lysate of nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 2 |
CNY 3080.00 |
|
| LY414039 | Transient overexpression lysate of nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 1 |
CNY 3080.00 |
|
| LY429495 | Transient overexpression lysate of nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 1 |
CNY 3080.00 |
|
| PH315425 | NR2E3 MS Standard C13 and N15-labeled recombinant protein (NP_055064) |
CNY 19520.00 |
|
| TP315425 | Recombinant protein of human nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP320677 | Recombinant protein of human nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 1, 20 µg |
CNY 2900.00 |


