AK3L1 (AK4) (NM_013410) Human Mass Spec Standard
CAT#: PH320572
AK3L1 MS Standard C13 and N15-labeled recombinant protein (NP_037542)
View other "AK3L1" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | AK3L1 MS Standard C13 and N15-labeled recombinant protein (NP_037542) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220572 |
| Predicted MW | 25.1 kDa |
| Protein Sequence |
>RC220572 representing NM_013410
Red=Cloning site Green=Tags(s) MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVIT RLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDF NPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLF SNKITPIQSKEAY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037542 |
| RefSeq Size | 2199 |
| RefSeq ORF | 669 |
| Synonyms | AK3; AK3L1; AK3L2; AK 4 |
| Locus ID | 205 |
| Cytogenetics | 1p31.3 |
| Summary | This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402259 | AK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404279 | AK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423694 | AK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430929 | AK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402259 | Transient overexpression lysate of adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 6 |
CNY 3080.00 |
|
| LY404279 | Transient overexpression lysate of adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 7 |
CNY 3080.00 |
|
| LY423694 | Transient overexpression lysate of adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 5 |
CNY 3080.00 |
|
| PH324463 | AK3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001005353) |
CNY 19520.00 |
|
| TP320572 | Recombinant protein of human adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 6, 20 µg |
CNY 2900.00 |
|
| TP324463 | Recombinant protein of human adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 5, 20 µg |
CNY 2900.00 |


