RIT1 (NM_006912) Human Mass Spec Standard
CAT#: PH320552
RIT1 MS Standard C13 and N15-labeled recombinant protein (NP_008843)
View other "RIT1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RIT1 MS Standard C13 and N15-labeled recombinant protein (NP_008843) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220552 |
| Predicted MW | 25.1 kDa |
| Protein Sequence |
>RC220552 protein sequence
Red=Cloning site Green=Tags(s) MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPAN LDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQ LRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSP FRKKKDSVT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008843 |
| RefSeq Size | 3455 |
| RefSeq ORF | 657 |
| Synonyms | NS8; RIBB; RIT; ROC1 |
| Locus ID | 6016 |
| Cytogenetics | 1q22 |
| Summary | This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416316 | RIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416316 | Transient overexpression lysate of Ras-like without CAAX 1 (RIT1) |
CNY 3080.00 |
|
| TP320552 | Recombinant protein of human Ras-like without CAAX 1 (RIT1), 20 µg |
CNY 2900.00 |
