Spastin (SPAST) (NM_014946) Human Mass Spec Standard
CAT#: PH320458
SPAST MS Standard C13 and N15-labeled recombinant protein (NP_055761)
View other "Spastin" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | SPAST MS Standard C13 and N15-labeled recombinant protein (NP_055761) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220458 |
| Predicted MW | 67 kDa |
| Protein Sequence |
>RC220458 representing NM_014946
Red=Cloning site Green=Tags(s) MNSPGGRGKKKGSGGASNPVPPRPPPPCLAPAPPAAGPAPPPESQHKRNLYYFSYPLFVGFALLRLVAFH LGLLFVWLCQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAG QKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLEKMQPVLPFSKSQTD VYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQ GSGPAPTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLA KQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGE KLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQ ELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGP IRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055761 |
| RefSeq Size | 5221 |
| RefSeq ORF | 1848 |
| Synonyms | ADPSP; FSP2; SPG4 |
| Locus ID | 6683 |
| Cytogenetics | 2p22.3 |
| Summary | This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The use of alternative translational initiation sites in this gene results in a single transcript variant that can produce isoforms that differ in the length of their N-terminus and which thereby differ in the efficiency of their export from the nucleus to the cytoplasm. In addition, alternative splicing results in multiple transcript variants that encode isoforms that differ in other protein regions as well. One isoform of this gene has been shown to be a microtubule-severing enzyme that regulates microtubule abundance, mobility, and plus-end distribution. Mutations in this gene cause the most frequent form of autosomal dominant spastic paraplegia 4. [provided by RefSeq, May 2018] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404560 | SPAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY404560 | Transient overexpression lysate of spastin (SPAST), transcript variant 2 |
CNY 4840.00 |
|
| PH314100 | SPAST MS Standard C13 and N15-labeled recombinant protein (NP_955468) |
CNY 14250.00 |
|
| TP314100 | Recombinant protein of human spastin (SPAST), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP320458 | Recombinant protein of human spastin (SPAST), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Spastin产品
