Calcipressin 1 (RCAN1) (NM_004414) Human Mass Spec Standard
CAT#: PH320434
RCAN1 MS Standard C13 and N15-labeled recombinant protein (NP_004405)
View other "Calcipressin 1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | RCAN1 MS Standard C13 and N15-labeled recombinant protein (NP_004405) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220434 |
| Predicted MW | 27.9 kDa |
| Protein Sequence |
>RC220434 representing NM_004414
Red=Cloning site Green=Tags(s) MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004405 |
| RefSeq Size | 2457 |
| RefSeq ORF | 756 |
| Synonyms | ADAPT78; CSP1; DSC1; DSCR1; MCIP1; RCN1 |
| Locus ID | 1827 |
| Cytogenetics | 21q22.12 |
| Summary | The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403714 | RCAN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403714 | Transient overexpression lysate of regulator of calcineurin 1 (RCAN1), transcript variant 3 |
CNY 3080.00 |
|
| TP320434 | Recombinant protein of human regulator of calcineurin 1 (RCAN1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760488 | Purified recombinant protein of Human regulator of calcineurin 1 (RCAN1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP760720 | Purified recombinant protein of Human regulator of calcineurin 1 (RCAN1), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它Calcipressin 1产品
