Integrin beta 4 binding protein (EIF6) (NM_181468) Human Mass Spec Standard
CAT#: PH320391
EIF6 MS Standard C13 and N15-labeled recombinant protein (NP_852133)
View other "Integrin beta 4 binding protein" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | EIF6 MS Standard C13 and N15-labeled recombinant protein (NP_852133) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220391 |
Predicted MW | 26.4 kDa |
Protein Sequence |
>RC220391 representing NM_181468
Red=Cloning site Green=Tags(s) MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGL LVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQ TVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT TSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_852133 |
RefSeq Size | 1259 |
RefSeq ORF | 735 |
Synonyms | b(2)gcn; CAB; eIF-6; EIF3A; ITGB4BP; p27(BBP); p27BBP |
Locus ID | 3692 |
Cytogenetics | 20q11.22 |
Summary | Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple non-protein coding transcript variants and variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405776 | EIF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405776 | Transient overexpression lysate of eukaryotic translation initiation factor 6 (EIF6), transcript variant 2 |
CNY 3080.00 |
|
TP320391 | Recombinant protein of human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Integrin beta 4 binding protein产品