PSMA4 (NM_001102667) Human Mass Spec Standard
CAT#: PH320385
PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_001096137)
View other "PSMA4" proteins (9)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 3080.00
Specifications
| Product Data | |
| Description | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_001096137) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC220385 | 
| Predicted MW | 29.5 kDa | 
| Protein Sequence | 
                 >RC220385 protein sequence 
Red=Cloning site Green=Tags(s) MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNE DMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWD KHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEK VEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001096137 | 
| RefSeq Size | 1159 | 
| RefSeq ORF | 783 | 
| Synonyms | HC9; HsT17706; PSC9 | 
| Locus ID | 5685 | 
| Cytogenetics | 15q25.1 | 
| Summary | This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq, Aug 2016] | 
| Protein Families | Druggable Genome, Protease | 
| Protein Pathways | Proteasome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419117 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC420186 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC420187 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY419117 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY420186 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY420187 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 3 | 
                                                     CNY 3080.00  | 
                                            |
| PH302786 | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_002780) | 
                                                     CNY 19520.00  | 
                                            |
| TP302786 | Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP320385 | Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
