PKA R2 (PRKAR2A) (NM_004157) Human Mass Spec Standard
CAT#: PH320376
PRKAR2A MS Standard C13 and N15-labeled recombinant protein (NP_004148)
View other "PKA R2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | PRKAR2A MS Standard C13 and N15-labeled recombinant protein (NP_004148) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220376 |
Predicted MW | 45.3 kDa |
Protein Sequence |
>RC220376 representing NM_004157
Red=Cloning site Green=Tags(s) MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDR VADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLF KNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELA LMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEK IYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAAS AYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004148 |
RefSeq Size | 2381 |
RefSeq ORF | 1212 |
Synonyms | PKR2; PRKAR2 |
Locus ID | 5576 |
Cytogenetics | 3p21.31 |
Summary | cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of cAMP-dependent protein kinase. This subunit has been shown to regulate protein transport from endosomes to the Golgi apparatus and further to the endoplasmic reticulum (ER). [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Apoptosis, Insulin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401337 | PRKAR2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401337 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type II, alpha (PRKAR2A) |
CNY 3080.00 |
|
TP320376 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type II, alpha (PRKAR2A), 20 µg |
CNY 2900.00 |