COQ7 (NM_016138) Human Mass Spec Standard
CAT#: PH320317
COQ7 MS Standard C13 and N15-labeled recombinant protein (NP_057222)
View other "COQ7" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | COQ7 MS Standard C13 and N15-labeled recombinant protein (NP_057222) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220317 |
| Predicted MW | 24.1 kDa |
| Protein Sequence |
>RC220317 representing NM_016138
Red=Cloning site Green=Tags(s) MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQ MAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVMFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVA VEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVA IYLSERL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057222 |
| RefSeq Size | 2591 |
| RefSeq ORF | 651 |
| Synonyms | CAT5; CLK-1; CLK1; COQ10D8 |
| Locus ID | 10229 |
| Cytogenetics | 16p12.3 |
| Summary | The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010] |
| Protein Pathways | Metabolic pathways, Ubiquinone and other terpenoid-quinone biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414165 | COQ7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433767 | COQ7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414165 | Transient overexpression lysate of coenzyme Q7 homolog, ubiquinone (yeast) (COQ7) |
CNY 3080.00 |
|
| LY433767 | Transient overexpression lysate of coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), transcript variant 2 |
CNY 3080.00 |
|
| TP320317 | Recombinant protein of human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), 20 µg |
CNY 2900.00 |
