Stathmin 1 (STMN1) (NM_203399) Human Mass Spec Standard
CAT＃: PH320276
STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981944)
View other "Stathmin 1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981944) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220276 |
| Predicted MW | 17.3 kDa |
| Protein Sequence |
>RC220276 protein sequence
Red=Cloning site Green=Tags(s) MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLK QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK DPADETEAD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_981944 |
| RefSeq Size | 1518 |
| RefSeq ORF | 447 |
| Synonyms | C1orf215; Lag; LAP18; OP18; PP17; PP19; PR22; SMN |
| Locus ID | 3925 |
| Cytogenetics | 1p36.11 |
| Summary | This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009] |
| Protein Pathways | MAPK signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404338 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404340 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417225 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429256 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404338 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 2 |
CNY 3080.00 |
|
| LY404340 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 1 |
CNY 3080.00 |
|
| LY417225 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 3 |
CNY 3080.00 |
|
| PH305073 | STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981946) |
CNY 19520.00 |
|
| PH313958 | STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_005554) |
CNY 19520.00 |
|
| TP305073 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP313958 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP320276 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720152 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 4 |
CNY 1800.00 |
其它Stathmin 1产品
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
