LHFPL3 (NM_199000) Human Mass Spec Standard
CAT#: PH320013
LHFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_945351)
View other "LHFPL3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LHFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_945351) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220013 |
Predicted MW | 25.8 kDa |
Protein Sequence |
>RC220013 protein sequence
Red=Cloning site Green=Tags(s) MPGAAAAAAAAAAAMLPTQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQA GYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIICFTLFFFCNTATVYKI CAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAIIGILDALILSFLAFVL GNRQDSLMAEELKAENKVLLSQYSLE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_945351 |
RefSeq Size | 3191 |
RefSeq ORF | 708 |
Synonyms | LHFPL4 |
Locus ID | 375612 |
Cytogenetics | 7q22.2-q22.3 |
Summary | This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. A partial gene fragment named LHFPL4 corresponds to a portion of the first exon of this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404712 | LHFPL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404712 | Transient overexpression lysate of lipoma HMGIC fusion partner-like 3 (LHFPL3) |
CNY 3080.00 |
|
TP320013 | Recombinant protein of human lipoma HMGIC fusion partner-like 3 (LHFPL3), 20 µg |
CNY 2900.00 |