LHFPL3 (NM_199000) Human Mass Spec Standard
CAT#: PH320013
LHFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_945351)
View other "LHFPL3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LHFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_945351) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220013 |
| Predicted MW | 25.8 kDa |
| Protein Sequence |
>RC220013 protein sequence
Red=Cloning site Green=Tags(s) MPGAAAAAAAAAAAMLPTQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQA GYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIICFTLFFFCNTATVYKI CAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAIIGILDALILSFLAFVL GNRQDSLMAEELKAENKVLLSQYSLE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_945351 |
| RefSeq Size | 3191 |
| RefSeq ORF | 708 |
| Synonyms | LHFPL4 |
| Locus ID | 375612 |
| Cytogenetics | 7q22.2-q22.3 |
| Summary | This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. A partial gene fragment named LHFPL4 corresponds to a portion of the first exon of this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404712 | LHFPL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404712 | Transient overexpression lysate of lipoma HMGIC fusion partner-like 3 (LHFPL3) |
CNY 3080.00 |
|
| TP320013 | Recombinant protein of human lipoma HMGIC fusion partner-like 3 (LHFPL3), 20 µg |
CNY 2900.00 |
