TCF21 (NM_198392) Human Mass Spec Standard
CAT#: PH320002
TCF21 MS Standard C13 and N15-labeled recombinant protein (NP_938206)
View other "TCF21" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TCF21 MS Standard C13 and N15-labeled recombinant protein (NP_938206) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220002 |
| Predicted MW | 19.5 kDa |
| Protein Sequence |
>RC220002 representing NM_198392
Red=Cloning site Green=Tags(s) MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLS GVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKY ENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_938206 |
| RefSeq Size | 3231 |
| RefSeq ORF | 537 |
| Synonyms | bHLHa23; POD1 |
| Locus ID | 6943 |
| Cytogenetics | 6q23.2 |
| Summary | TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405044 | TCF21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418825 | TCF21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405044 | Transient overexpression lysate of transcription factor 21 (TCF21), transcript variant 1 |
CNY 3080.00 |
|
| LY418825 | Transient overexpression lysate of transcription factor 21 (TCF21), transcript variant 2 |
CNY 3080.00 |
|
| TP320002 | Recombinant protein of human transcription factor 21 (TCF21), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP761400 | Purified recombinant protein of Human transcription factor 21 (TCF21), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |

