LASP1 (NM_006148) Human Mass Spec Standard
CAT#: PH319975
LASP1 MS Standard C13 and N15-labeled recombinant protein (NP_006139)
View other "LASP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LASP1 MS Standard C13 and N15-labeled recombinant protein (NP_006139) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219975 |
| Predicted MW | 29.5 kDa |
| Protein Sequence |
>RC219975 representing NM_006148
Red=Cloning site Green=Tags(s) MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006139 |
| RefSeq Size | 3846 |
| RefSeq ORF | 783 |
| Synonyms | Lasp-1; MLN50 |
| Locus ID | 3927 |
| Cytogenetics | 17q12 |
| Summary | This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer. [provided by RefSeq, Oct 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416835 | LASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416835 | Transient overexpression lysate of LIM and SH3 protein 1 (LASP1) |
CNY 3080.00 |
|
| TP319975 | Recombinant protein of human LIM and SH3 protein 1 (LASP1), 20 µg |
CNY 2900.00 |
