TGF beta Receptor II (TGFBR2) (NM_003242) Human Mass Spec Standard
CAT#: PH319855
TGFBR2 MS Standard C13 and N15-labeled recombinant protein (NP_003233)
View other "TGF beta Receptor II" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | TGFBR2 MS Standard C13 and N15-labeled recombinant protein (NP_003233) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219855 |
Predicted MW | 64.57 kDa |
Protein Sequence |
>RC219855 representing NM_003242
Red=Cloning site Green=Tags(s) MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSN CSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS DECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLM EFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP YEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKL GSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDN VLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPED GSLNTTK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003233 |
RefSeq Size | 4639 |
RefSeq ORF | 1701 |
Synonyms | AAT3; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; TAAD2; TBR-ii; TBRII; TGFbeta-RII; TGFR-2 |
Locus ID | 7048 |
Cytogenetics | 3p24.1 |
Summary | The protein encoded by this gene is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of genes related to cell proliferation, cell cycle arrest, wound healing, immunosuppression, and tumorigenesis. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Adherens junction, Chronic myeloid leukemia, Colorectal cancer, Cytokine-cytokine receptor interaction, Endocytosis, MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401116 | TGFBR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401116 | Transient overexpression lysate of transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2 |
CNY 4840.00 |
|
TP319855 | Recombinant protein of human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP721073 | Purified recombinant protein of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2 |
CNY 1800.00 |
其它TGF beta Receptor II产品