CD30 (TNFRSF8) (NM_001243) Human Mass Spec Standard
CAT#: PH319819
TNFRSF8 MS Standard C13 and N15-labeled recombinant protein (NP_001234)
View other "CD30" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | TNFRSF8 MS Standard C13 and N15-labeled recombinant protein (NP_001234) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219819 |
Predicted MW | 63.75 kDa |
Protein Sequence |
>RC219819 representing NM_001243
Red=Cloning site Green=Tags(s) MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCE PDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFP GTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTR APDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRT CECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSP TQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASP AGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHY PEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001234 |
RefSeq Size | 3686 |
RefSeq ORF | 1785 |
Synonyms | CD30; D1S166E; Ki-1 |
Locus ID | 943 |
Cytogenetics | 1p36.22 |
Summary | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420050 | TNFRSF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY420050 | Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1 |
CNY 4840.00 |
|
TP319819 | Recombinant protein of human tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP710113 | Recombinant protein of human tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, residues 19-379aa, with C-terminal DDK tag,expressed in sf9 cells |
CNY 4020.00 |
|
TP721319 | Human CD30/TNFRSF8 Protein (C-His) |
CNY 2450.00 |
|
TP721320 | Human CD30/TNFRSF8 Protein (C-His-Avi) |
CNY 2450.00 |
|
TP721321 | Biotinylated Human CD30/TNFRSF8 Protein (C-His-Avi) |
CNY 3480.00 |
|
TP721322 | PE Conjugated Human CD30/TNFRSF8 Protein (C-His) |
CNY 3480.00 |
|
TP721323 | APC Conjugated Human CD30/TNFRSF8 Protein (C-His) |
CNY 3480.00 |
|
TP724016 | Human CD30 Protein, His tag |
CNY 5249.00 |