GPR73A (PROKR1) (NM_138964) Human Mass Spec Standard
CAT#: PH319745
PROKR1 MS Standard C13 and N15-labeled recombinant protein (NP_620414)
View other "GPR73A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PROKR1 MS Standard C13 and N15-labeled recombinant protein (NP_620414) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219745 |
| Predicted MW | 44.6 kDa |
| Protein Sequence |
>RC219745 representing NM_138964
Red=Cloning site Green=Tags(s) METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFAAKIVIGMALV GIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCTSV NYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTATGLIALVWTVSILIAIPSAYFTTETVLVIVK SQEKIFCGQIWPVDQQLYYKSYFLFIFGIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRR KTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTV KYFKKIMLLHWKASYNGGKSSADLDLKTIGMPATEEVDCIRLK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_620414 |
| RefSeq Size | 1182 |
| RefSeq ORF | 1179 |
| Synonyms | GPR73; GPR73a; PK-R1; PKR1; ZAQ |
| Locus ID | 10887 |
| Cytogenetics | 2p13.3 |
| Summary | This gene encodes a member of the G-protein-coupled receptor family. The encoded protein binds to prokineticins (1 and 2), leading to the activation of MAPK and STAT signaling pathways. Prokineticins are protein ligands involved in angiogenesis and inflammation. The encoded protein is expressed in peripheral tissues such as those comprising the circulatory system, lungs, reproductive system, endocrine system and the gastrointestinal system. The protein may be involved in signaling in human fetal ovary during initiation of primordial follicle formation. Sequence variants in this gene may be associated with recurrent miscarriage. [provided by RefSeq, Aug 2016] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403372 | PROKR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403372 | Transient overexpression lysate of prokineticin receptor 1 (PROKR1) |
CNY 3080.00 |
|
| TP319745 | Recombinant protein of human prokineticin receptor 1 (PROKR1), 20 µg |
CNY 2900.00 |
