GnRH (GNRH1) (NM_001083111) Human Mass Spec Standard
CAT＃: PH319734
GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_001076580)
View other "GnRH" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_001076580) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219734 |
| Predicted MW | 10.4 kDa |
| Protein Sequence |
>RC219734 protein sequence
Red=Cloning site Green=Tags(s) MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS PLRDLKGALESLIEEETGQKKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001076580 |
| RefSeq Size | 1297 |
| RefSeq ORF | 276 |
| Synonyms | GNRH; GRH; LHRH; LNRH |
| Locus ID | 2796 |
| Cytogenetics | 8p21.2 |
| Summary | This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | GnRH signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421206 | GNRH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424503 | GNRH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421206 | Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2 |
CNY 3080.00 |
|
| LY424503 | Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1 |
CNY 3080.00 |
|
| PH312991 | GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_000816) |
CNY 19520.00 |
|
| TP312991 | Recombinant protein of human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP319734 | Recombinant protein of human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2, 20 µg |
CNY 2900.00 |
