TPD52L2 (NM_199359) Human Mass Spec Standard
CAT#: PH319692
TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_955391)
View other "TPD52L2" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_955391) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219692 |
Predicted MW | 19.7 kDa |
Protein Sequence |
>RC219692 representing NM_199359
Red=Cloning site Green=Tags(s) MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAK ERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRN SATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_955391 |
RefSeq Size | 2297 |
RefSeq ORF | 559 |
Synonyms | D54; TPD54 |
Locus ID | 7165 |
Cytogenetics | 20q13.33 |
Summary | This gene encodes a member of the tumor protein D52-like family. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. Expression of this gene may be a marker for breast cancer and acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 12. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401134 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404541 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404543 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401134 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 5 |
CNY 3080.00 |
|
LY404541 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 6 |
CNY 3080.00 |
|
LY404543 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 2 |
CNY 3080.00 |
|
PH301547 | TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_003279) |
CNY 19520.00 |
|
TP301547 | Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 5, 20 µg |
CNY 2900.00 |
|
TP319692 | Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 6, 20 µg |
CNY 2900.00 |
其它TPD52L2产品