Galectin 10 (CLC) (NM_001828) Human Mass Spec Standard
CAT#: PH319689
CLC MS Standard C13 and N15-labeled recombinant protein (NP_001819)
View other "Galectin 10" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CLC MS Standard C13 and N15-labeled recombinant protein (NP_001819) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219689 |
Predicted MW | 16.3 kDa |
Protein Sequence |
>RC219689 representing NM_001828
Red=Cloning site Green=Tags(s) MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYG AWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYL KR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001819 |
RefSeq Size | 641 |
RefSeq ORF | 426 |
Synonyms | Gal-10; GAL10; LGALS10; LGALS10A; LPPL_HUMAN |
Locus ID | 1178 |
Cytogenetics | 19q13.2 |
Summary | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419729 | CLC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419729 | Transient overexpression lysate of Charcot-Leyden crystal protein (CLC) |
CNY 3080.00 |
|
TP319689 | Recombinant protein of human Charcot-Leyden crystal protein (CLC), 20 µg |
CNY 2900.00 |
其它Galectin 10产品