COX8C (NM_182971) Human Mass Spec Standard
CAT#: PH319625
COX8C MS Standard C13 and N15-labeled recombinant protein (NP_892016)
View other "COX8C" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | COX8C MS Standard C13 and N15-labeled recombinant protein (NP_892016) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219625 |
| Predicted MW | 8.1 kDa |
| Protein Sequence |
>RC219625 protein sequence
Red=Cloning site Green=Tags(s) MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFR RN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_892016 |
| RefSeq Size | 531 |
| RefSeq ORF | 216 |
| Synonyms | COX8-3 |
| Locus ID | 341947 |
| Cytogenetics | 14q32.12 |
| Summary | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
| Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405286 | COX8C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405286 | Transient overexpression lysate of cytochrome c oxidase subunit 8C (COX8C), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP319625 | Recombinant protein of human cytochrome c oxidase subunit 8C (COX8C), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
