DUSP18 (NM_152511) Human Mass Spec Standard
CAT#: PH319496
DUSP18 MS Standard C13 and N15-labeled recombinant protein (NP_689724)
View other "DUSP18" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DUSP18 MS Standard C13 and N15-labeled recombinant protein (NP_689724) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219496 |
| Predicted MW | 20.9 kDa |
| Protein Sequence |
>RC219496 representing NM_152511
Red=Cloning site Green=Tags(s) MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVP VADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPI IRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689724 |
| RefSeq Size | 2453 |
| RefSeq ORF | 564 |
| Synonyms | DSP18; DUSP20; LMWDSP20 |
| Locus ID | 150290 |
| Cytogenetics | 22q12.2 |
| Summary | Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407513 | DUSP18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407513 | Transient overexpression lysate of dual specificity phosphatase 18 (DUSP18) |
CNY 3080.00 |
|
| TP319496 | Recombinant protein of human dual specificity phosphatase 18 (DUSP18), 20 µg |
CNY 2900.00 |
