DEFB106A (NM_152251) Human Mass Spec Standard
CAT#: PH319477
DEFB106A MS Standard C13 and N15-labeled recombinant protein (NP_689464)
View other "DEFB106A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DEFB106A MS Standard C13 and N15-labeled recombinant protein (NP_689464) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219477 |
| Predicted MW | 7.4 kDa |
| Protein Sequence |
>RC219477 protein sequence
Red=Cloning site Green=Tags(s) MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689464 |
| RefSeq Size | 325 |
| RefSeq ORF | 195 |
| Synonyms | BD-6; DEFB-6; DEFB106 |
| Locus ID | 245909 |
| Cytogenetics | 8p23.1 |
| Summary | Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Chromosome 8p23 contains at least two copies of the duplicated beta-defensin cluster. This duplication results in two identical copies of defensin, beta 106, DEFB106A and DEFB106B, in head-to-head orientation. This gene, DEFB106A, represents the more centromeric copy. [provided by RefSeq, Oct 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407680 | DEFB106A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407680 | Transient overexpression lysate of defensin, beta 106A (DEFB106A) |
CNY 3080.00 |
|
| TP319477 | Recombinant protein of human defensin, beta 106A (DEFB106A), 20 µg |
CNY 2900.00 |
其它DEFB106A产品
