Synapsin III (SYN3) (NM_003490) Human Mass Spec Standard
CAT#: PH319395
SYN3 MS Standard C13 and N15-labeled recombinant protein (NP_003481)
View other "Synapsin III" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SYN3 MS Standard C13 and N15-labeled recombinant protein (NP_003481) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219395 |
Predicted MW | 63.1 kDa |
Protein Sequence |
>RC219395 representing NM_003490
Red=Cloning site Green=Tags(s) MNFLRRRLSDSSFMANLPNGYMTDLQRPDSSTSSPASPAMERRHPQPLAASFSSPGSSLFSSLSSAMKQA PQATSGLMEPPGPSTPIVQRPRILLVIDDAHTDWSKYFHGKKVNGEIEIRVEQAEFSELNLAAYVTGGCM VDMQVVRNGTKVVSRSFKPDFILVRQHAYSMALGEDYRSLVIGLQYGGLPAVNSLYSVYNFCSKPWVFSQ LIKIFHSLGPEKFPLVEQTFFPNHKPMVTAPHFPVVVKLGHAHAGMGKIKVENQLDFQDITSVVAMAKTY ATTEAFIDSKYDIRIQKIGSNYKAYMRTSISGNWKANTGSAMLEQVAMTERYRLWVDSCSEMFGGLDICA VKAVHSKDGRDYIIEVMDSSMPLIGEHVEEDRQLMADLVVSKMSQLPMPGGTAPSPLRPWAPQIKSAKSP GQAQLGPQLGQPQPRPPPQGGPRQAQSPQPQRSGSPSQQRLSPQGQQPLSPQSGSPQQQRSPGSPQLSRA SSGSSPNQASKPGATLASQPRPPVQGRSTSQQGEESKKPAPPHPHLNKSQSLTNSLSTSDTSQRGTPSED EAKAETIRNLRKSFASLFSD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003481 |
RefSeq Size | 2918 |
RefSeq ORF | 1740 |
Locus ID | 8224 |
Cytogenetics | 22q12.3 |
Summary | This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. The protein encoded by this gene shares the synapsin family domain model, with domains A, C, and E exhibiting the highest degree of conservation. The protein contains a unique domain J, located between domains C and E. Based on this gene's localization to 22q12.3, a possible schizophrenia susceptibility locus, and the established neurobiological roles of the synapsins, this family member may represent a candidate gene for schizophrenia. The TIMP3 gene is located within an intron of this gene and is transcribed in the opposite direction. Alternative splicing of this gene results in multiple splice variants that encode different isoforms. [provided by RefSeq, Oct 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401178 | SYN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC408773 | SYN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401178 | Transient overexpression lysate of synapsin III (SYN3), transcript variant IIIa |
CNY 4840.00 |
|
LY408773 | Transient overexpression lysate of synapsin III (SYN3), transcript variant IIIc |
CNY 4840.00 |
|
TP319395 | Recombinant protein of human synapsin III (SYN3), transcript variant IIIa, 20 µg |
CNY 2900.00 |
其它Synapsin III产品