Glutaredoxin 1 (GLRX) (NM_002064) Human Mass Spec Standard
CAT#: PH319385
GLRX MS Standard C13 and N15-labeled recombinant protein (NP_002055)
View other "Glutaredoxin 1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GLRX MS Standard C13 and N15-labeled recombinant protein (NP_002055) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219385 |
| Predicted MW | 11.6 kDa |
| Protein Sequence |
>RC219385 representing NM_002064
Red=Cloning site Green=Tags(s) MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002055 |
| RefSeq Size | 1328 |
| RefSeq ORF | 318 |
| Synonyms | GRX; GRX1 |
| Locus ID | 2745 |
| Cytogenetics | 5q15 |
| Summary | This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400755 | GLRX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426531 | GLRX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400755 | Transient overexpression lysate of glutaredoxin (thioltransferase) (GLRX), transcript variant 1 |
CNY 3080.00 |
|
| LY426531 | Transient overexpression lysate of glutaredoxin (thioltransferase) (GLRX), transcript variant 2 |
CNY 3080.00 |
|
| PH325029 | GLRX MS Standard C13 and N15-labeled recombinant protein (NP_001112362) |
CNY 19520.00 |
|
| TP319385 | Recombinant protein of human glutaredoxin (thioltransferase) (GLRX), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325029 | Recombinant protein of human glutaredoxin (thioltransferase) (GLRX), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Glutaredoxin 1产品
