IL15 (NM_172174) Human Mass Spec Standard
CAT#: PH319294
IL15 MS Standard C13 and N15-labeled recombinant protein (NP_751914)
View other "IL15" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | IL15 MS Standard C13 and N15-labeled recombinant protein (NP_751914) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219294 |
| Predicted MW | 14.7 kDa |
| Protein Sequence |
>RC219294 representing NM_172174
Red=Cloning site Green=Tags(s) MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHID ATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELE EKNIKEFLQSFVHIVQMFINTS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_751914 |
| RefSeq Size | 1969 |
| RefSeq ORF | 486 |
| Synonyms | IL-15; Interleukin 15; MGC9721; OTTHUMP00000164617 |
| Locus ID | 3600 |
| Cytogenetics | 4q31.21 |
| Summary | The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403532 | IL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403532 | Transient overexpression lysate of interleukin 15 (IL15), transcript variant 1 |
CNY 3080.00 |
|
| TP319294 | Recombinant protein of human interleukin 15 (IL15), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720014 | Recombinant protein of human interleukin 15 (IL15) |
CNY 3140.00 |
|
| TP723710 | Purified recombinant protein of Human interleukin 15 (IL15), transcript variant 3 |
CNY 5330.00 |
|
| TP750223 | Purified recombinant protein of Human interleukin 15 (IL15), transcript variant 3, 49Asn-End, 100ug |
CNY 4890.00 |
