Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Mass Spec Standard
CAT#: PH319231
TRH MS Standard C13 and N15-labeled recombinant protein (NP_009048)
View other "Thyrotropin Releasing Hormone" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TRH MS Standard C13 and N15-labeled recombinant protein (NP_009048) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219231 |
| Predicted MW | 27.4 kDa |
| Protein Sequence |
>RC219231 protein sequence
Red=Cloning site Green=Tags(s) MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009048 |
| RefSeq Size | 1890 |
| RefSeq ORF | 726 |
| Synonyms | Pro-TRH; TRF |
| Locus ID | 7200 |
| Cytogenetics | 3q22.1 |
| Summary | This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. [provided by RefSeq, May 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416185 | TRH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416185 | Transient overexpression lysate of thyrotropin-releasing hormone (TRH) |
CNY 3080.00 |
|
| TP319231 | Recombinant protein of human thyrotropin-releasing hormone (TRH), 20 µg |
CNY 2900.00 |
其它Thyrotropin Releasing Hormone产品
