PRPS2 (NM_001039091) Human Mass Spec Standard
CAT#: PH319227
PRPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001034180)
View other "PRPS2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PRPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001034180) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219227 |
| Predicted MW | 34.9 kDa |
| Protein Sequence |
>RC219227 representing NM_001039091
Red=Cloning site Green=Tags(s) MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMEL LIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHIITMDLHASQIQGF FDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVL VGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQ EDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001034180 |
| RefSeq Size | 2518 |
| RefSeq ORF | 963 |
| Synonyms | PRSII |
| Locus ID | 5634 |
| Cytogenetics | Xp22.2 |
| Summary | This gene encodes a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pentose phosphate pathway, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419123 | PRPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422014 | PRPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419123 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2 |
CNY 3080.00 |
|
| LY422014 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1 |
CNY 3080.00 |
|
| TP319227 | Recombinant protein of human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1, 20 µg |
CNY 2900.00 |
