EDARADD (NM_080738) Human Mass Spec Standard
CAT#: PH319198
EDARADD MS Standard C13 and N15-labeled recombinant protein (NP_542776)
View other "EDARADD" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | EDARADD MS Standard C13 and N15-labeled recombinant protein (NP_542776) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219198 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC219198 representing NM_080738
Red=Cloning site Green=Tags(s) MASPDDPLRADHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFP DSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSY DELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_542776 |
RefSeq Size | 2891 |
RefSeq ORF | 615 |
Synonyms | ECTD11A; ECTD11B; ED3; EDA3 |
Locus ID | 128178 |
Cytogenetics | 1q42.3-q43 |
Summary | This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403313 | EDARADD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403442 | EDARADD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403313 | Transient overexpression lysate of EDAR-associated death domain (EDARADD), transcript variant B |
CNY 3080.00 |
|
LY403442 | Transient overexpression lysate of EDAR-associated death domain (EDARADD), transcript variant A |
CNY 3080.00 |
|
TP319198 | Recombinant protein of human EDAR-associated death domain (EDARADD), transcript variant B, 20 µg |
CNY 2900.00 |
其它EDARADD产品