MRPL42 (NM_014050) Human Mass Spec Standard
CAT#: PH319175
MRPL42 MS Standard C13 and N15-labeled recombinant protein (NP_054769)
View other "MRPL42" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | MRPL42 MS Standard C13 and N15-labeled recombinant protein (NP_054769) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219175 |
Predicted MW | 16.7 kDa |
Protein Sequence |
>RC219175 protein sequence
Red=Cloning site Green=Tags(s) MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYE HTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPK DR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054769 |
RefSeq Size | 3139 |
RefSeq ORF | 426 |
Synonyms | HSPC204; L31MT; L42MT; MRP-L31; MRP-L42; MRP-S32; MRPL31; MRPS32; PTD007; RPML31; S32MT |
Locus ID | 28977 |
Cytogenetics | 12q22 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein identified as belonging to both the 28S and the 39S subunits. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 4q, 6p, 6q, 7p, and 15q. [provided by RefSeq, May 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406765 | MRPL42 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406766 | MRPL42 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415469 | MRPL42 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406765 | Transient overexpression lysate of mitochondrial ribosomal protein L42 (MRPL42), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
LY406766 | Transient overexpression lysate of mitochondrial ribosomal protein L42 (MRPL42), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3080.00 |
|
LY415469 | Transient overexpression lysate of mitochondrial ribosomal protein L42 (MRPL42), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
TP319175 | Recombinant protein of human mitochondrial ribosomal protein L42 (MRPL42), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP761941 | Purified recombinant protein of Human mitochondrial ribosomal protein L42 (MRPL42), nuclear gene encoding mitochondrial protein, transcript variant 2,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |