C11orf85 (MAJIN) (NM_001037225) Human Mass Spec Standard
CAT#: PH319046
C11orf85 MS Standard C13 and N15-labeled recombinant protein (NP_001032302)
View other "C11orf85" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C11orf85 MS Standard C13 and N15-labeled recombinant protein (NP_001032302) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219046 |
Predicted MW | 24.8 kDa |
Protein Sequence |
>RC219046 protein sequence
Red=Cloning site Green=Tags(s) MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEDSVRVVLGNLDNLQPFATEHF IVFPYKSKWERVSHLKFKHGEIILIPYPFVFTLYVEMKWFHENLSPGKPISDSPLGLVPVEKKAVGAVMR KRKHMDEPSSPSRPGLDRIGKEKPNKDCRRLWPLISLMSRNKILSGDTACQGELSHPCSTTHLHLRSEQP PASLGF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001032302 |
RefSeq Size | 1291 |
RefSeq ORF | 648 |
Synonyms | C11orf85 |
Locus ID | 283129 |
Cytogenetics | 11q13.1 |
Summary | Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1-TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. In the complex, MAJIN acts as the anchoring subunit to the nucleus inner membrane. MAJIN shows DNA-binding activity, possibly for the stabilization of telomere attachment on the nucleus inner membrane.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421932 | C11orf85 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421932 | Transient overexpression lysate of chromosome 11 open reading frame 85 (C11orf85) |
CNY 3080.00 |
|
TP319046 | Recombinant protein of human chromosome 11 open reading frame 85 (C11orf85), 20 µg |
CNY 2900.00 |
其它C11orf85产品