Caspase 1 (CASP1) (NM_033294) Human Mass Spec Standard
CAT#: PH318982
CASP1 MS Standard C13 and N15-labeled recombinant protein (NP_150636)
View other "Caspase 1" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CASP1 MS Standard C13 and N15-labeled recombinant protein (NP_150636) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218982 |
Predicted MW | 29.6 kDa |
Protein Sequence |
>RC218982 representing NM_033294
Red=Cloning site Green=Tags(s) MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTR LALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLV FMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDNVSWRHPTMGSVFIG RLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_150636 |
RefSeq Size | 941 |
RefSeq ORF | 789 |
Synonyms | ICE; IL1BC; P45 |
Locus ID | 834 |
Cytogenetics | 11q22.3 |
Summary | This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. [provided by RefSeq, Mar 2012] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409612 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409613 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420065 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429054 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409612 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant gamma |
CNY 3080.00 |
|
LY409613 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta |
CNY 3080.00 |
|
LY420065 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant beta |
CNY 3080.00 |
|
TP318982 | Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta, 20 µg |
CNY 2900.00 |
|
TP760190 | Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
TP761213 | Purified recombinant protein of -Human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant alpha, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
|
TP762669 | Purified recombinant protein of Human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant alpha, 120Asn-297Asp, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2480.00 |
其它Caspase 1产品