EGFL7 (NM_016215) Human Mass Spec Standard
CAT#: PH318849
EGFL7 MS Standard C13 and N15-labeled recombinant protein (NP_057299)
View other "EGFL7" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | EGFL7 MS Standard C13 and N15-labeled recombinant protein (NP_057299) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218849 |
Predicted MW | 29.4 kDa |
Protein Sequence |
>RC218849 representing NM_016215
Red=Cloning site Green=Tags(s) MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYR TAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDE CSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLL EEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057299 |
RefSeq Size | 1569 |
RefSeq ORF | 819 |
Synonyms | NEU1; VE-STATIN; ZNEU1 |
Locus ID | 51162 |
Cytogenetics | 9q34.3 |
Summary | This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402519 | EGFL7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404428 | EGFL7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402519 | Transient overexpression lysate of EGF-like-domain, multiple 7 (EGFL7), transcript variant 1 |
CNY 3080.00 |
|
LY404428 | Transient overexpression lysate of EGF-like-domain, multiple 7 (EGFL7), transcript variant 2 |
CNY 3080.00 |
|
TP318849 | Purified recombinant protein of Homo sapiens EGF-like-domain, multiple 7 (EGFL7), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP761665 | Purified recombinant protein of Human EGF-like-domain, multiple 7 (EGFL7), transcript variant 1, transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |