JAML (NM_001098526) Human Mass Spec Standard
CAT#: PH318818
AMICA1 MS Standard C13 and N15-labeled recombinant protein (NP_001091996)
View other "JAML" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | AMICA1 MS Standard C13 and N15-labeled recombinant protein (NP_001091996) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218818 |
| Predicted MW | 44.2 kDa |
| Protein Sequence |
>RC218818 representing NM_001098526
Red=Cloning site Green=Tags(s) MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLSPGEHAKDEYV LYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRLKGESQVFKKAVVLHVLPEEP KELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSGRRAKEEIVFRYYHKLRMSVEYSQSWGHFQNRVNLVG DIFRNDGSIMLQGVRESDGGNYTCSIHLGNLVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVG IVCATILLLPVLILIVKKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEE EEPSEKSEATYMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001091996 |
| RefSeq Size | 1957 |
| RefSeq ORF | 1182 |
| Synonyms | AMICA; AMICA1; CREA7-1; CREA7-4; Gm638 |
| Locus ID | 120425 |
| Cytogenetics | 11q23.3 |
| Summary | Transmembrane protein of the plasma membrane of leukocytes that control their migration and activation through interaction with CXADR, a plasma membrane receptor found on adjacent epithelial and endothelial cells. The interaction between both receptors mediates the activation of gamma-delta T-cells, a subpopulation of T-cells residing in epithelia and involved in tissue homeostasis and repair. Upon epithelial CXADR-binding, JAML induces downstream cell signaling events in gamma-delta T-cells through PI3-kinase and MAP kinases. It results in proliferation and production of cytokines and growth factors by T-cells that in turn stimulate epithelial tissues repair. It also controls the transmigration of leukocytes within epithelial and endothelial tissues through adhesive interactions with epithelial and endothelial CXADR.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407136 | AMICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420624 | AMICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407136 | Transient overexpression lysate of adhesion molecule, interacts with CXADR antigen 1 (AMICA1), transcript variant 2 |
CNY 3080.00 |
|
| LY420624 | Transient overexpression lysate of adhesion molecule, interacts with CXADR antigen 1 (AMICA1), transcript variant 1 |
CNY 3080.00 |
|
| TP318818 | Recombinant protein of human adhesion molecule, interacts with CXADR antigen 1 (AMICA1), transcript variant 1, 20 µg |
CNY 2900.00 |
