CAMK2D (NM_172115) Human Mass Spec Standard
CAT#: PH318801
CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742113)
View other "CAMK2D" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742113) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218801 |
| Predicted MW | 53.9 kDa |
| Protein Sequence |
>RC218801 representing NM_172115
Red=Cloning site Green=Tags(s) MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKH PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPE NLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVG YPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVAS MMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEI IKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_742113 |
| RefSeq Size | 2151 |
| RefSeq ORF | 1434 |
| Synonyms | CAMKD |
| Locus ID | 817 |
| Cytogenetics | 4q26 |
| Summary | The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a delta chain. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Distinct isoforms of this chain have different expression patterns.[provided by RefSeq, Nov 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406847 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406848 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406849 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430342 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406847 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 4 |
CNY 3080.00 |
|
| LY406848 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 1 |
CNY 3080.00 |
|
| LY406849 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 2 |
CNY 3080.00 |
|
| LY430342 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 5 |
CNY 3080.00 |
|
| PH307454 | CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742125) |
CNY 19520.00 |
|
| PH322121 | CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742126) |
CNY 19520.00 |
|
| TP307454 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP318801 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP322121 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 2, 20 µg |
CNY 2900.00 |
