STK19 (NM_004197) Human Mass Spec Standard
CAT#: PH318770
STK19 MS Standard C13 and N15-labeled recombinant protein (NP_004188)
View other "STK19" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | STK19 MS Standard C13 and N15-labeled recombinant protein (NP_004188) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218770 |
| Predicted MW | 40.3 kDa |
| Protein Sequence |
>RC218770 representing NM_004197
Red=Cloning site Green=Tags(s) MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGG GDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLR GEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAH GIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRD AGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDC ISTTSGTLLRLPET myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004188 |
| RefSeq Size | 1620 |
| RefSeq ORF | 1092 |
| Synonyms | D6S60; D6S60E; G11; HLA-RP1; RP1 |
| Locus ID | 8859 |
| Cytogenetics | 6p21.33 |
| Summary | This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410091 | STK19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418155 | STK19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410091 | Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 2 |
CNY 3080.00 |
|
| LY418155 | Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 1 |
CNY 3080.00 |
|
| TP318770 | Purified recombinant protein of Homo sapiens serine/threonine kinase 19 (STK19), transcript variant 1, 20 µg |
CNY 2900.00 |
