MRAP (NM_206898) Human Mass Spec Standard
CAT#: PH318683
MRAP MS Standard C13 and N15-labeled recombinant protein (NP_996781)
View other "MRAP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | MRAP MS Standard C13 and N15-labeled recombinant protein (NP_996781) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218683 |
| Predicted MW | 11.3 kDa |
| Protein Sequence |
>RC218683 representing NM_206898
Red=Cloning site Green=Tags(s) MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSWSASPQMSF NTDESLLHSEVLPQTRAISCDELQAPREEGAA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_996781 |
| RefSeq Size | 656 |
| RefSeq ORF | 306 |
| Synonyms | B27; C21orf61; FALP; FGD2; GCCD2 |
| Locus ID | 56246 |
| Cytogenetics | 21q22.11 |
| Summary | This gene encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mutations in this gene have been associated with familial glucocorticoid deficiency type 2. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404158 | MRAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404158 | Transient overexpression lysate of melanocortin 2 receptor accessory protein (MRAP), transcript variant 2 |
CNY 3080.00 |
|
| TP318683 | Purified recombinant protein of Homo sapiens melanocortin 2 receptor accessory protein (MRAP), transcript variant 2, 20 µg |
CNY 2900.00 |
