ELAVL4 (NM_021952) Human Mass Spec Standard
CAT＃: PH318612
ELAVL4 MS Standard C13 and N15-labeled recombinant protein (NP_068771)
View other "ELAVL4" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
热销推荐Specifications
| Product Data | |
| Description | ELAVL4 MS Standard C13 and N15-labeled recombinant protein (NP_068771) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218612 |
| Predicted MW | 41.6 kDa |
| Protein Sequence |
>RC218612 representing NM_021952
Red=Cloning site Green=Tags(s) MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACSPRFSPITIDG MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE AAMAIASLNGYRLGDRVLQVSFKTNKAHKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_068771 |
| RefSeq Size | 1591 |
| RefSeq ORF | 1140 |
| Synonyms | HUD; PNEM |
| Locus ID | 1996 |
| Cytogenetics | 1p33-p32.3 |
| Summary | May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3' UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411863 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428514 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428515 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428517 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411863 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 1 |
CNY 3080.00 |
|
| LY428514 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 2 |
CNY 3080.00 |
|
| LY428515 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 3 |
CNY 3080.00 |
|
| LY428517 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 5 |
CNY 3080.00 |
|
| TP318612 | Recombinant protein of human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 1, 20 µg |
CNY 2900.00 |
