SPRED3 (NM_001039616) Human Mass Spec Standard
CAT#: PH318601
SPRED3 MS Standard C13 and N15-labeled recombinant protein (NP_001034705)
View other "SPRED3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SPRED3 MS Standard C13 and N15-labeled recombinant protein (NP_001034705) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218601 |
Predicted MW | 16.1 kDa |
Protein Sequence |
>RC218601 representing NM_001039616
Red=Cloning site Green=Tags(s) MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKTTLECTLKPGL VYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTPSSSSSSSSPSQDTAETPCPL TLSQYFRHMLCP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001034705 |
RefSeq Size | 543 |
RefSeq ORF | 456 |
Synonyms | Eve-3; spred-3 |
Locus ID | 399473 |
Cytogenetics | 19q13.2 |
Summary | This gene encodes a protein with a C-terminal Sprouty-like cysteine-rich domain (SRY) and an N-terminal Ena/Vasodilator-stimulated phosphoprotein (VASP) homology-1 (EVH-1) domain. The encoded protein is a member of a family of proteins that negatively regulates mitogen-activated protein (MAP) kinase signaling, particularly during organogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420960 | SPRED3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422092 | SPRED3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420960 | Transient overexpression lysate of sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 1 |
CNY 3080.00 |
|
LY422092 | Transient overexpression lysate of sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 2 |
CNY 3080.00 |
|
TP318601 | Recombinant protein of human sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 2, 20 µg |
CNY 2900.00 |