OSGIN1 (NM_013370) Human Mass Spec Standard
CAT#: PH318475
OSGIN1 MS Standard C13 and N15-labeled recombinant protein (NP_037502)
View other "OSGIN1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | OSGIN1 MS Standard C13 and N15-labeled recombinant protein (NP_037502) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218475 |
| Predicted MW | 60.7 kDa |
| Protein Sequence |
>RC218475 representing NM_013370
Red=Cloning site Green=Tags(s) MGKWRPRGCCRGNMQCRQEVPATLTSSELFSTRNQPQPQPQPLLADAPVPWAVASRMCLTPGQGCGHQGQ DEGPLPAPSPPPAMSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKL TEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHVVLGRNLP GGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAV VTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWARNVVLATGTFDSPARLGIPGEALPFIHH ELSALEAATRVGAVTPASDPVLIIGAGLSAADAVLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEY HKVHQMMREQSILSPSPYEGYRSLPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPG AGADFAVDPDQPLSAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037502 |
| RefSeq Size | 2400 |
| RefSeq ORF | 1680 |
| Synonyms | BDGI; OKL38 |
| Locus ID | 29948 |
| Cytogenetics | 16q23.3 |
| Summary | This gene encodes an oxidative stress response protein that regulates cell death. Expression of the gene is regulated by p53 and is induced by DNA damage. The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears to be a key regulator of both inflammatory and anti-inflammatory molecules. The loss of this protein correlates with uncontrolled cell growth and tumor formation. Naturally occurring read-through transcription exists between this gene and the neighboring upstream malonyl-CoA decarboxylase (MLYCD) gene, but the read-through transcripts are unlikely to produce a protein product. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405295 | OSGIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415630 | OSGIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY405295 | Transient overexpression lysate of oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 3 |
CNY 3080.00 |
|
| LY415630 | Transient overexpression lysate of oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 1 |
CNY 4840.00 |
|
| TP318475 | Recombinant protein of human oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 1, 20 µg |
CNY 2900.00 |
