C14orf151 (INF2) (NM_032714) Human Mass Spec Standard
CAT#: PH318469
INF2 MS Standard C13 and N15-labeled recombinant protein (NP_116103)
View other "C14orf151" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | INF2 MS Standard C13 and N15-labeled recombinant protein (NP_116103) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218469 |
Predicted MW | 26 kDa |
Protein Sequence |
>RC218469 protein sequence
Red=Cloning site Green=Tags(s) MSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGSDGGWMVQFLE QSGLDLLLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVK KQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPED LRARTQLRNEFIGLQLLDVLARLR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116103 |
RefSeq Size | 1719 |
RefSeq ORF | 702 |
Synonyms | C14orf151; C14orf173; CMTDIE; FSGS5; pp9484 |
Locus ID | 64423 |
Cytogenetics | 14q32.33 |
Summary | This gene represents a member of the formin family of proteins. It is considered a diaphanous formin due to the presence of a diaphanous inhibitory domain located at the N-terminus of the encoded protein. Studies of a similar mouse protein indicate that the protein encoded by this locus may function in polymerization and depolymerization of actin filaments. Mutations at this locus have been associated with focal segmental glomerulosclerosis 5.[provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409977 | INF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411560 | INF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY409977 | Transient overexpression lysate of inverted formin, FH2 and WH2 domain containing (INF2), transcript variant 3 |
CNY 3080.00 |
|
LY411560 | Transient overexpression lysate of inverted formin, FH2 and WH2 domain containing (INF2), transcript variant 1 |
CNY 4840.00 |
|
PH316716 | INF2 MS Standard C13 and N15-labeled recombinant protein (NP_071934) |
CNY 19520.00 |
|
TP316716 | Recombinant protein of human inverted formin, FH2 and WH2 domain containing (INF2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP318469 | Recombinant protein of human chromosome 14 open reading frame 151 (C14orf151), 20 µg |
CNY 2900.00 |
其它C14orf151产品