REC114 (NM_001042367) Human Mass Spec Standard
CAT#: PH318438
C15orf60 MS Standard C13 and N15-labeled recombinant protein (NP_001035826)
View other "REC114" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | C15orf60 MS Standard C13 and N15-labeled recombinant protein (NP_001035826) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218438 |
| Predicted MW | 29 kDa |
| Protein Sequence |
>RC218438 representing NM_001042367
Red=Cloning site Green=Tags(s) MAEAGKVPLSLGLTGGEAAEWPLQRYARCIPSNTRDPPGPCLEAGTAPCPTWKVFDSNEESGYLVLTIVI SGHFFIFQGQTLLEGFSLIGSKDWLKIVRRVDCLLFGTTIKDKSRLFRVQFSGESKEQALEHCCSCVQKL AQYITVQVPDGNIQELQLIPGPPRATESQGKDSAKSVPRQPGSHQHSEQQQVCVTAGTGAPDGRTSLTQL AQTLLASEELPHVYEQSAWGAEELGPFLRLCLMDQNFPAFVEEVEKELKKLAGLRN SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035826 |
| RefSeq Size | 938 |
| RefSeq ORF | 798 |
| Synonyms | C15orf60; CT147; OOMD10 |
| Locus ID | 283677 |
| Cytogenetics | 15q24.1 |
| Summary | The protein encoded by this gene is orthologous to the mouse meiotic recombination protein REC114, which is involved in DNA double-strand break formation during meiosis. The encoded protein is conserved in most eukaryotes and was first discovered and characterized in yeast. [provided by RefSeq, Feb 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420856 | REC114 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420856 | Transient overexpression lysate of chromosome 15 open reading frame 60 (C15orf60) |
CNY 3080.00 |
|
| TP318438 | Recombinant protein of human chromosome 15 open reading frame 60 (C15orf60), 20 µg |
CNY 2900.00 |
