CMTM7 (NM_181472) Human Mass Spec Standard
CAT#: PH318395
CMTM7 MS Standard C13 and N15-labeled recombinant protein (NP_852137)
View other "CMTM7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CMTM7 MS Standard C13 and N15-labeled recombinant protein (NP_852137) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218395 |
| Predicted MW | 15.3 kDa |
| Protein Sequence |
>RC218395 representing NM_181472
Red=Cloning site Green=Tags(s) MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTN YSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSIFGFMATFLCMASIWLSYKISCVTQSTDA AV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_852137 |
| RefSeq Size | 1270 |
| RefSeq ORF | 426 |
| Synonyms | CKLFSF7 |
| Locus ID | 112616 |
| Cytogenetics | 3p22.3 |
| Summary | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408668 | CMTM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408668 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 1 |
CNY 3080.00 |
|
| TP318395 | Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2, 20 µg |
CNY 2900.00 |


