Monoacylglycerol Lipase (MGLL) (NM_007283) Human Mass Spec Standard
CAT#: PH318358
MGLL MS Standard C13 and N15-labeled recombinant protein (NP_009214)
View other "Monoacylglycerol Lipase" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | MGLL MS Standard C13 and N15-labeled recombinant protein (NP_009214) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218358 |
| Predicted MW | 34.1 kDa |
| Protein Sequence |
>RC218358 representing NM_007283
Red=Cloning site Green=Tags(s) METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAIL TAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLI CRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHV LHKELPEVTNSVFHEINMWVSQRTATAGTASPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009214 |
| RefSeq Size | 4617 |
| RefSeq ORF | 939 |
| Synonyms | HU-K5; HUK5; MAGL; MGL |
| Locus ID | 11343 |
| Cytogenetics | 3q21.3 |
| Summary | This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Glycerolipid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402124 | MGLL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402124 | Transient overexpression lysate of monoglyceride lipase (MGLL), transcript variant 1 |
CNY 3080.00 |
|
| TP318358 | Recombinant protein of human monoglyceride lipase (MGLL), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Monoacylglycerol Lipase产品


