DMC1 (NM_007068) Human Mass Spec Standard
CAT#: PH318311
DMC1 MS Standard C13 and N15-labeled recombinant protein (NP_008999)
View other "DMC1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 6281.00
Specifications
| Product Data | |
| Description | DMC1 MS Standard C13 and N15-labeled recombinant protein (NP_008999) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218311 |
| Predicted MW | 37.7 kDa |
| Protein Sequence |
>RC218311 protein sequence
Red=Cloning site Green=Tags(s) MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKV DKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLC VTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKF HEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTF QADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008999 |
| RefSeq Size | 2281 |
| RefSeq ORF | 1020 |
| Synonyms | dJ199H16.1; DMC1H; LIM15 |
| Locus ID | 11144 |
| Cytogenetics | 22q13.1 |
| Summary | This gene encodes a member of the superfamily of recombinases (also called DNA strand-exchange proteins). Recombinases are important for repairing double-strand DNA breaks during mitosis and meiosis. This protein, which is evolutionarily conserved, is reported to be essential for meiotic homologous recombination and may thus play an important role in generating diversity of genetic information. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416201 | DMC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416201 | Transient overexpression lysate of DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast) (DMC1) |
CNY 3080.00 |
|
| TP318311 | Recombinant protein of human DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast) (DMC1), 20 µg |
CNY 2900.00 |
