HPR (NM_020995) Human Mass Spec Standard
CAT#: PH318300
HPR MS Standard C13 and N15-labeled recombinant protein (NP_066275)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | HPR MS Standard C13 and N15-labeled recombinant protein (NP_066275) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218300 |
| Predicted MW | 38.8 kDa |
| Protein Sequence |
>RC218300 representing NM_020995
Red=Cloning site Green=Tags(s) MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLN DKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLL TTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLP SKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHT FCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_066275 |
| RefSeq Size | 1245 |
| RefSeq ORF | 1044 |
| Synonyms | A-259H10.2; HP |
| Locus ID | 3250 |
| Cytogenetics | 16q22.2 |
| Summary | This gene encodes a haptoglobin-related protein that binds hemoglobin as efficiently as haptoglobin. Unlike haptoglobin, plasma concentration of this protein is unaffected in patients with sickle cell anemia and extensive intravascular hemolysis, suggesting a difference in binding between haptoglobin-hemoglobin and haptoglobin-related protein-hemoglobin complexes to CD163, the hemoglobin scavenger receptor. This protein may also be a clinically important predictor of recurrence of breast cancer. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412112 | HPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412112 | Transient overexpression lysate of haptoglobin-related protein (HPR) |
CNY 3080.00 |
|
| TP318300 | Recombinant protein of human haptoglobin-related protein (HPR), 20 µg |
CNY 2900.00 |
|
| TP750140 | Purified recombinant protein of Human haptoglobin-related protein (HPR),Leu20-End, with N-terminal His tag, expressed in E. coli, 100ug |
CNY 4020.00 |
