PKI alpha (PKIA) (NM_006823) Human Mass Spec Standard
CAT＃: PH318237
PKIA MS Standard C13 and N15-labeled recombinant protein (NP_006814)
View other "PKI alpha" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PKIA MS Standard C13 and N15-labeled recombinant protein (NP_006814) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218237 |
| Predicted MW | 8 kDa |
| Protein Sequence |
>RC218237 protein sequence
Red=Cloning site Green=Tags(s) MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGE AAKSES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006814 |
| RefSeq Size | 4215 |
| RefSeq ORF | 228 |
| Synonyms | PRKACN1 |
| Locus ID | 5569 |
| Cytogenetics | 8q21.13 |
| Summary | The protein encoded by this gene is a member of the cAMP-dependent protein kinase (PKA) inhibitor family. This protein was demonstrated to interact with and inhibit the activities of both C alpha and C beta catalytic subunits of the PKA. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402041 | PKIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405612 | PKIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402041 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 6 |
CNY 3080.00 |
|
| LY405612 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 7 |
CNY 3080.00 |
|
| TP318237 | Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 6, 20 µg |
CNY 2900.00 |
|
| TP760478 | Purified recombinant protein of Human protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP762524 | Purified recombinant protein of Human protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 1, full length, 50ug |
CNY 2480.00 |
其它PKI alpha产品
